AI Jobs Map

Rainstream Technologies · Ahmedabad, Gujarat

Full-Stack Website Developer

RemotePosted 3 days ago
Apply on IndeedOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

wordpressshopifyphphtmlcssjavascriptmysqlapi-designtypescriptreactnext.jsrest-apinode.jspythonlaravelexpress.jspostgresqlmongodbsupabasefirebase

Full-Stack Website Developer

WordPress | Shopify | Wix | Squarespace | WooCommerce | Custom Development | AI-Assisted Development

Job Type: Contract-Based
Shift: Night Shift
Employment Type: Full-Time Contract
Location: Ahmedabad / Remote

Job Overview

We are looking for a highly skilled and versatile Full-Stack Website Developer to join our team on a contract basis for the night shift.

The ideal candidate should be capable of designing, developing, customizing, optimizing, and maintaining modern websites across multiple platforms, including WordPress, WooCommerce, Shopify, Wix, Squarespace, and custom-coded applications.

This is not a no-code-only position. We are looking for a developer who can efficiently use website-building platforms and modern AI development tools while also having strong technical skills to build custom functionality whenever required.

The ideal candidate should be equally comfortable launching a small business website, developing a high-converting e-commerce store, customizing WordPress or Shopify functionality, integrating third-party APIs, troubleshooting production issues, and developing custom frontend and backend solutions.

Key Responsibilities

You will be responsible for developing and maintaining a variety of digital experiences, including:

- Corporate and business websites

- Startup websites

- Landing pages

- Lead-generation websites

- E-commerce stores

- WooCommerce websites

- Shopify stores

- Membership websites

- Service-based business websites

- Portfolio websites

- Custom web applications

- Client portals

- Booking and scheduling systems

- Subscription websites

- Multi-location websites

- Website redesigns and migrations

- Custom dashboards and interfaces

- API-connected websites

- CRM-integrated websites

- AI-enabled web experiences

WordPress Development

Develop, customize, optimize, and maintain professional WordPress websites using:

- WordPress

- WooCommerce

- Elementor / Elementor Pro

- Gutenberg

- Advanced Custom Fields (ACF)

- Custom Themes

- Child Themes

- Custom Plugins

- PHP

- HTML

- CSS

- JavaScript

- MySQL

The candidate should be able to work beyond page builders when required and troubleshoot WordPress issues at the:

- Code level

- Database level

- Plugin level

- Theme level

- Hosting level

- Server level

WooCommerce Development

Develop complete and customized e-commerce experiences using WooCommerce, including:

- Product catalogs

- Variable products

- Shopping carts

- Checkout customization

- Payment gateway integrations

- Shipping configurations

- Tax configurations

- Coupons and discount systems

- Subscription systems

- Membership systems

- Customer accounts

- Order management

- Product filtering

- Inventory systems

- Email notifications

- Custom checkout flows

- Third-party integrations

Shopify Development

Build, customize, and maintain Shopify stores.

Responsibilities may include:

- Shopify theme customization

- Shopify Liquid development

- HTML, CSS, and JavaScript customization

- Product and collection setup

- Navigation architecture

- Checkout optimization

- Shopify app integrations

- Custom sections and components

- Storefront customization

- Conversion optimization

- Shopify API integrations

- Payment and shipping configuration

- Product filtering

- Subscription integrations

- Analytics implementation

Experience with Shopify 2.0 will be strongly preferred.

Wix & Wix Studio Development

Develop professional and responsive Wix and Wix Studio websites, including:

- Responsive website development

- CMS collections

- Dynamic pages

- Forms

- Automations

- Booking systems

- E-commerce functionality

- Membership functionality

- Custom JavaScript

- Velo development

- Third-party integrations

Squarespace Development

Build and customize Squarespace websites using:

- Squarespace templates

- Custom CSS

- Custom JavaScript

- Code injection

- E-commerce functionality

- Membership functionality

- Forms

- Scheduling systems

- Third-party integrations

Custom Full-Stack Development

The candidate must also be comfortable working outside traditional website builders.

Frontend Technologies

- HTML5

- CSS3

- JavaScript

- TypeScript

- React.js

- Next.js

- Responsive UI development

- REST APIs

- JSON

Backend Technologies

Experience with one or more of the following is preferred:

- Node.js

- PHP

- Python

- Laravel

- Express.js

- Next.js backend functionality

Databases

Experience with databases such as:

- MySQL

- PostgreSQL

- MongoDB

- Supabase

- Firebase

AI-Assisted Development

We actively use Artificial Intelligence to improve development speed, productivity, and efficiency.

The candidate should be comfortable using AI-assisted development tools for:

- Code generation

- Code refactoring

- Debugging

- Documentation

- API integration

- UI development

- Component generation

- Testing

- Research

- Troubleshooting

- Database queries

- Content implementation

- SEO implementation

- Accessibility checks

- Development planning

Experience with AI development tools such as the following will be an advantage:

- ChatGPT

- Claude

- GitHub Copilot

- Cursor

- Replit

- Lovable

- Other AI-assisted development environments

AI should accelerate your abilities—not replace them.

The developer must understand the code being produced, verify its quality, troubleshoot issues, maintain security standards, and manually develop solutions when AI-generated code is insufficient.

Integrations & API Development

The candidate should be comfortable integrating websites and applications with:

- REST APIs

- Webhooks

- Stripe

- PayPal

- Square

- Google APIs

- Meta integrations

- CRM systems

- GoHighLevel

- HubSpot

- Salesforce

- Zapier

- Make

- Email marketing platforms

- SMS platforms

- Scheduling platforms

- Analytics tools

- AI APIs

- OpenAI APIs

Website Performance & Technical Optimization

The candidate should have a strong understanding of:

- Website speed optimization

- Core Web Vitals

- Image optimization

- Caching

- CDN configuration

- Database optimization

- JavaScript optimization

- CSS optimization

- Mobile responsiveness

- Browser compatibility

- Accessibility

- SSL

- DNS

- Domain management

- Hosting environments

SEO Implementation

You do not need to be an SEO strategist; however, you should understand how website development impacts SEO.

Knowledge of the following is required:

- Meta information

- Heading hierarchy

- Schema markup

- XML sitemaps

- Redirects

- Canonical URLs

- Robots.txt

- Alt text implementation

- Page speed optimization

- Mobile optimization

- Analytics implementation

- Google Search Console

- Google Tag Manager

- GA4

Security & Development Standards

Developers must follow secure development and deployment practices, including:

- Secure authentication

- Proper user permissions

- Input validation

- Secure API handling

- Environment variable management

- API key and secret protection

- Plugin security

- Dependency management

- Regular backups

- Malware prevention

- Staging environments

- Version control using Git

- Code reviews

- Production deployment procedures

Required Skills & Qualifications

- Strong experience in website development and customization.

- Hands-on experience with WordPress and WooCommerce.

- Experience with Shopify development and Liquid.

- Experience with Wix / Wix Studio and Velo.

- Experience with Squarespace customization.

- Strong knowledge of HTML, CSS, JavaScript, and PHP.

- Experience with React.js and/or Next.js will be an advantage.

- Experience with backend technologies such as Node.js, Laravel, PHP, or Python.

- Strong understanding of APIs, webhooks, and third-party integrations.

- Experience working with databases.

- Knowledge of website hosting, domains, DNS, SSL, and deployment processes.

- Experience using Git and version control systems.

- Ability to troubleshoot complex website and production issues independently.

- Comfortable working with AI-assisted development tools.

- Strong problem-solving and debugging skills.

- Good communication and documentation skills.

- Ability to work independently and manage multiple projects.

Important Note

This is not a no-code or page-builder-only role.

While experience with platforms such as WordPress, Shopify, Wix, and Squarespace is important, the selected candidate must also have the ability to:

- Write and understand custom code.

- Customize platform functionality.

- Develop custom frontend and backend features.

- Integrate third-party systems and APIs.

- Troubleshoot technical and production-level issues.

- Review and validate AI-generated code.

- Build custom solutions when templates or plugins are insufficient.

Working Conditions

- Job Type: Contract-Based

- Shift: Night Shift

- Candidates must be comfortable working independently and coordinating with team members and clients during night-shift working hours.

Why Join Us?

- Opportunity to work on diverse website and e-commerce projects.

- Exposure to multiple modern web development platforms.

- Work with AI-assisted development tools and workflows.

- Opportunity to develop both platform-based and custom full-stack solutions.

- Exposure to international projects and modern web technologies.

- Work on challenging integrations, APIs, AI-enabled experiences, and custom development projects.

Pay: From ₹40,000.00 per year

Work Location: Remote

More jobs at Rainstream Technologies