AI Jobs Map

7-Eleven Global Solution Center – India · Bengaluru, Karnataka, India

Software Engineer II- QA

full timePosted 13 days ago
Apply on LinkedInLinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

unit-testingazuredevopsci/cdplaywrightapi-testingsqlawsmongodb

Role Description

Job Summary

We are looking for a QA Engineer with strong experience in Manual and Automation Testing The candidate will be responsible for ensuring product quality through test planning, execution, automation development, and collaboration with cross-functional teams.

Key Responsibilities

- Design and execute manual test cases for web applications.

- Develop and maintain automation test scripts

- Perform functional, regression, integration, and end-to-end testing.

- Validate APIs and database transactions.

- Report, track, and verify defects using Jira/Azure DevOps.

- Integrate and execute automated tests in CI/CD pipelines.

- Collaborate closely with Product Owners, Developers, and QA teams.

Required Skills

- 5–8 years of QA experience in Manual and Automation Testing.

- Hands-on experience with any Automation Framework.( good to have Playwright experience).

- Experience with API Testing (Postman).

- Good understanding of SQL and database validation.

- Experience working in Agile/Scrum environments.

Good to Have

- Knowledge of AWS services.

- Experience with MongoDB.

- Retail/Store Technology domain experience (POS, Inventory, Ordering etc.).

More jobs at 7-Eleven Global Solution Center – India

  • 7-Eleven Global Solution Center – India · Bengaluru, Karnataka, India

    yesterday

    MEP Engineer - Electrical

    Hybridmid_levelexcelLinkedIn
  • 7-Eleven Global Solution Center – India · Bengaluru, Karnataka, India

    3 days ago

    Data Analyst I

    Hybriddata-analysisdatabrickssqlpython+4LinkedIn
  • 7-Eleven Global Solution Center – India · Bengaluru, Karnataka, India

    5 days ago

    Software Engineer II

    Hybridawsmongodbapplication-securityjavascript+4LinkedIn
  • 7-Eleven Global Solution Center – India · Bengaluru, Karnataka, India

    9 days ago

    Lead Data Scientist

    Hybridseniordata-sciencedata-warehousingawsazure+4LinkedIn
  • 7-Eleven Global Solution Center – India · Bengaluru, Karnataka, India

    12 days ago

    Global Service desk/ Technical support

    seniorLinkedIn