AI Jobs Map

Sytac · Amsterdam Area

Software Engineer in Test

Hybridseniorfull timePosted 19 days ago
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

test-automationci/cdjavaseleniumdockerazuredevopsopentelemetrygrafanaspring.netsqllinuxapi-designobservabilityapi-testing

Sytac is looking for a proactive Software Engineer in Test (SDET) / Automation Engineer / Test Engineer to join one of our dedicated engineering teams embedded within a leading global financial services client. In this role, you will work within the Mortgages domain, helping to maintain, test, and elevate critical mortgage application systems on a hybrid Windows platform.

As a Sytac consultant, you will blend functional application management with deep test automation and CI/CD engineering—ensuring system stability, automated regression coverage, and seamless software deliveries.

The Project & Tech Stack

You will join an Agile squad operating in two-week sprints in Amsterdam, collaborating closely across domains and system integrations. The application landscape features high-volume APIs, virtualized infrastructure, and modern deployment pipelines:

- Testing & Automation: Java, Selenium, BDD, End-to-End Automated Suites, Docker

- CI/CD & Ops: Azure DevOps (Pipelines), Azure Insights, OpenTelemetry, Grafana, Kibana

- Backend & Data: Spring Boot framework, .NET layers, Oracle, MS SQL (Windows & Linux platforms)

- Ways of Working: Agile/Scrum/Kanban, automated regression testing, production monitoring

Roles & Responsibilities

- Functional & System Maintenance: Manage functional operations, user support, and troubleshooting across complex mortgage application systems and API integrations.

- Test Automation & Quality: Build, run, and maintain automated regression test suites using Java, Selenium, and BDD practices in private cloud and Docker environments.

- CI/CD & Release Management: Build and optimize Microsoft deployment pipelines in Azure DevOps, supporting bi-weekly software releases and streamlining regulatory compliance processes.

- Monitoring & Observability: Implement performance tuning, monitoring, and alerting through Azure Insights and OpenTelemetry to guarantee system reliability.

- Operational Continuity: Participate in scheduled Thursday evening production releases (approx. 1 evening every 6 weeks) and a 24/7 on-call standby rotation (approx. 1 week every 10 weeks, fully compensated).

- Stakeholder Collaboration: Actively connect with stakeholders across the mortgage test chain, review documentation, and proactively share knowledge across teams.

How to Succeed

- Domain & Testing Expertise: Functional knowledge of financial applications or mortgage products, paired with expert-level API testing and automated test framework skills.

- Technical Tooling: Solid hands-on experience with Java/Selenium, Docker, virtual test environments, and Azure DevOps pipelines.

- Troubleshooting & Ops: Strong analytical mindset with the ability to diagnose issues deep into application layers (.NET/Java), alongside monitoring experience (Azure Insights, Grafana, Kibana).

- Communication: Strong verbal and written communication skills in both English and Dutch.

- Consulting Mindset: A proactive, quality-focused attitude—comfortable challenging decisions, providing direct feedback, and driving continuous improvement in complex corporate environments.

Life at Sytac

Working at Sytac means joining a community that prioritizes your growth. Our benefits package is designed for flexibility, learning, and adventure:

- Unlimited Growth Days: Enjoy your professional development and Sytac activities! 📚

- The Best Gear: Pick a private laptop (<€4,000) with 50% paid by us, plus a tech budget. 💻

- Invest in You: A €2,400 annual growth budget for training and conferences. 🌿

- Future Proof: We contribute 3.75% to your pension.

- Legendary Trips: Join our annual ski trips, beach BBQs, and epic parties! ⛷️

More jobs at Sytac