AI Jobs Map

OP · Plano, TX

Solutions Architect

seniorcontractPosted today
Apply on LinkedInLinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

awsjavapython.netjavascriptangularreactgraphqlapache-kafkaetlspringmicroservicesserverlessdockerkubernetesionicflutterswiftseleniumjunit

Are you a visionary Solutions Architect ready to make a real impact? We are on the lookout for a dynamic innovator to lead the design and deployment of transformative technological solutions. In this pivotal role, you'll collaborate across teams to craft scalable, secure, and high-performance systems that shape the future of technology. If you're passionate about pushing boundaries and delivering solutions that matter, this is your chance to elevate your career and drive meaningful change with us!

Responsibilities:

- Oversee the solution architecture and design for key projects, delivering accurate estimates and coordinating with architects and designers across solution, infrastructure, and data disciplines to effectively address business challenges.

- Collaborate with delivery teams, production support, and Shared Services partners (such as Quality Assurance, Infrastructure Engineering, and Reference Architecture) to ensure alignment of solution strategies and estimates.

- Work closely with business stakeholders to identify problems, create new business capabilities, and design technology solutions that drive success, ensuring all solutions align with business requirements while emphasizing performance, scalability, security, and cost-efficiency.

- Provide architectural guidance by collaborating with portfolio teams, IT departments, and external partners. Present strategies, incorporate feedback, and foster collaboration with cross-functional technical teams.

- Embed within Scrum teams by engaging in daily standups and ceremonies, providing architectural direction, and guiding and mentoring technical teams through complex architectural challenges while ensuring alignment with best practices and project goals.

- Continuously assess and recommend specific tools, platforms, and frameworks that meet evolving project needs, ensuring high compatibility and efficiency.

- Promote and implement modular design principles to facilitate independent component development and testing, while consistently applying best security practices such as least privilege and data protection across all systems.

- Conduct quality and security assurance, developing metrics to drive and maintain code quality standards, and ensuring adherence to automated code review processes.

- Evaluate design options by creating high-level cost estimates for various architectural approaches, ensuring solutions are scalable, secure, and high-performing with a focus on cost-efficiency.

- Design and review high-availability and disaster-recovery architectures, proactively identifying areas for improvement and remediating issues to meet project and enterprise standards.

Qualifications:

- Bachelor’s or Master’s degree in Computer Science, Information Technology, or a related field.

- 10+ years of IT experience, with at least 3 years as a developer and 3 years as a solution architect.

- AWS Certified Solution Architect certification is strongly preferred.

- TOGAF certification is a plus.

Experience:

- Application.

- Programming languages such as Java, Python, .NET, or similar. Java preferred.

- JavaScript frameworks such as Angular and React for building user interfaces.

- RESTful APIs, GraphQL, and SOAP for interaction between applications and services.

- Event streaming and messaging brokers like Apache Kafka, AWS Kinesis, AWS SNS and SQS, or ActiveMQ.

- Batch Processing (e.g., ETL and Spring Batch).

- Microservices architecture.

- Serverless, including AWS Lambda.

- Containerization, including Docker and Kubernetes.

- Design patterns like MVC (Model-View-Controller), Strangler, and SOA (Service-Oriented Architecture).

- API gateway and management tools like Apigee and Amazon API Gateway.

- Domain Driven Design.

- Integration platforms like Spring Integration are used to connect diverse systems.

- Mobile app development frameworks (e.g., Ionic, Capacitor, React Native, Flutter, or Swift).

- Workflow and process engines such as AWS Step Functions, Camunda, Floowable, and Pega.

- Document management systems like Hyland Alfresco.

- Content management platforms like Adobe AEM and a general eCommerce experience.

- Testing tools like Selenium, JUnit, or TestNG create automated unit, integration, and performance tests.

- Cloud and DevOps.

- Architecture and detailed design of solutions using cloud platforms like AWS, Microsoft Azure, or Google Cloud.

- DevOps, including CI/CD pipelines (e.g., GitHub Actions).

- Infrastructure as Code (e.g., Terraform and OpenTofu).

- Data.

- SQL databases such as Oracle, PostgreSQL, or Microsoft SQL Server for structured data storage.

- NoSQL databases like DynamoDB for handling unstructured or semi-structured data.

- Normalizing data models and understanding the trade-offs of denormalization in large-scale systems.

- Enterprise data architecture includes operational data stores, data replication, data lakes, and data warehousing.

- Cyber and Privacy.

- Security frameworks like ISO 27001, NIST, or GDPR compliance.

- Compliance standards like CCPA and GDPR are particularly relevant when dealing with sensitive business data.

- Secure coding practices and principles, such as OWASP, encryption techniques, and identity management.

- Authentication protocols (OAuth, JWT) and identity management solutions (e.g., Azure AD, ForgeRock, SailPoint).

Benefits:

- 401(k).

- Dental Insurance.

- Health insurance.

- Vision insurance.

- We are an equal-opportunity employer and value diversity, equality, inclusion, and respect for people.

- The salary will be determined based on several factors, including, but not limited to, location, relevant education, qualifications, experience, technical skills, and business needs.

Additional Responsibilities:

- Participate in OP monthly team meetings and participate in team-building efforts.

- Contribute to OP technical discussions, peer reviews, etc.

- Contribute content and collaborate via the OP-Wiki/Knowledge Base.

- Provide status reports to OP Account Management as requested.

About us:

At OP, we help you harness the power of technology for maximum impact. A technology consulting and solutions company, we offer advisory and managed services, innovative platforms, and staffing solutions across a wide range of fields including AI, cyber security, enterprise architecture, and beyond. For nearly two decades, we’ve been challenging the status quo of the consulting industry, serving up fresh, ingenious thinking through a radically lean structure. Together, this strategy delivers unprecedented performance at an unparalleled pace for faster results that propel your business forward.

More jobs at OP

Similar roles in Dallas