AI Jobs Map

GFT TECHNOLOGIES · 30-302 Kraków

Python Engineer with AI skills

HybridPosted yesterday
Apply on IndeedIndeedOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

pythonmicroservicesapi-designflaskfastapidjangodevopsdockerci/cdazuregcpawsllmragsqllangchainvector-databasesobservabilityopenaietl

Type of contract: Employment contract

Salary range: 14580–22350 PLN gross per month

What will you do?

As a Senior Software Engineer, you will delivering end-to-end solutions from business requirement through development to production support. You will operate in an agile team environment, contributing to iterative delivery, ensuring technical quality, and maintaining system stability while balancing ongoing improvements and new development initiatives.

Your tasks

- Work within a team of 4–6 engineers with a dedicated product owner.

- Take business requirements, divide them into stories, and deliver them iteratively to production.

- Participate in analysis, development, testing, and production support as part of the same role.

- Ensure product stability by providing ongoing production support.

- Identify areas of technical debt and help balance it with new functionality.

- Design solutions aligned with technology guidelines and constraints.

- Collaborate with team members through pairing and knowledge sharing.

Your skills

- Strong experience in Python.

- Solid backend engineering fundamentals: microservices, API design, service integration, clean code and maintainable architecture.

- Experience with Flask / FastAPI / Django.

- Practical cloud/devops basics: containers (Docker) and CI/CD exposure; comfort working in cloud environments (Azure/GCP/AWS).

- LLM awareness: working knowledge of LLM application patterns (e.g., prompt fundamentals, RAG basics, tool/function calling concepts) or strong motivation to learn and apply them in real products.

- SQL and practical experience with relational databases.

- Confidence in delivering production-quality code: testing mindset (unit/integration tests), debugging and operational support.

- Clear communicator in spoken and written English, comfortable working with local and distributed teams.

- Full‑stack mindset: willingness to collaborate across the stack and learn frontend where needed

Nice to have

- Hands-on experience building LLM applications (agents, tool/function calling, RAG pipelines).

- Experience with LangChain / LangGraph or similar orchestration frameworks.

- Experience with vector databases and retrieval/search patterns.

- LLM evaluation/observability tools (e.g., LangSmith/LangFuse or similar).

- Cloud LLM platform experience (e.g., Azure OpenAI or equivalent).

- Strong data/ETL familiarity (pandas/numpy) and pragmatic data handling.

- Finance/markets domain experience (FX/Rates).

- Experience with Kubernetes and mature CI/CD practices.

- Familiarity with internal GenAI learning paths / programmes (prompt engineering, RAG, agents, LLMOps).

We offer

- Hybrid work from our client office in Kraków (6 days a month). We are open to candidates from another locations who are willing to travel to Kraków 6 days a month.

- Working in a highly experienced and dedicated team.

- Benefit package tailored to your needs (medical, sport, lunch subsidy, life insurance, etc.).

- Online training and certifications.

- Access to e-learning platform.

- Social events.

GDPR clause

Based on Regulation (EU) 2016/679 of the European Parliament and of the Council of 27 April 2016 on the protection of natural persons with regard to the processing of personal data and on the free movement of such a data and repealing Directive 95 /46/EC (known as a “GDPR”), I hereby give consent to GFT Poland Sp. z o.o. (90-118 Łódź, ul. Kilińskiego 66) to process my personal data for the purpose of: a) ongoing recruitment process for the position I am applying; b) recruitment processes organized in the future.

.buttontext616d4705bd22aece a{ border: 1px solid transparent; } .buttontext616d4705bd22aece a:focus{ border: 1px dashed #972875 !important; outline: none !important; }
We are GFT Poland. WE KNOW how to tackle complex issues with innovative approach to deliver the highest value. Our reputation has been built around one simple rule: we do not overpromise, WE DELIVER. We deliver to our employees, clients and partners. WE GROW as you grow, so investing in you is our business strategy. Caring for each other is our priority. WE CARE who you are, what you need, how you feel. WE CARE to smile, have fun and develop as human beings.
.buttontext51d9fe5a33d0d42c a{ border: 1px solid transparent; } .buttontext51d9fe5a33d0d42c a:focus{ border: 1px dashed #972875 !important; outline: none !important; }
Why Choose GFT?
A culture of top performance
Deep tech IT engineering & consulting
1200 skilled & top-class experts
77% of the team are regular/senior
Products that contribute to a sustainable world
Competitive salary and benefits
Ambitious projects, trainings and tools you need to flourish
Google Cloud Partner of the Year - for going above and beyond for customers
.jobColumnTwo .displayDTM h2 { margin-top: 0px !important; } .jobColumnTwo .displayDT ul{ padding-inline-start: 20px !important; list-style-position: outside !important; }
.buttontextb636f3111304c10b a{ border: 1px solid transparent; } .buttontextb636f3111304c10b a:focus{ border: 1px dashed #972875 !important; outline: none !important; }

More jobs at GFT TECHNOLOGIES