AI Jobs Map

Steadily Insurance Agency · Austin, TX

Senior Software Engineering Manager

seniorfull timePosted 7 days ago
Apply on IndeedOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

data-scienceswiftdata-analysispythonkotlintypescriptreactnext.jsdjangofastapipostgresqlapache-kafkaawseksgithub-actionsci/cd

Location: Austin, TX

Employment Type: Full-time, In-Office

Department: Engineering

Salary: Top of market salary + equity

We're hiring a Senior Software Engineering Manager to lead and scale our engineering organization.

As a (former) individual contributor, you developed innovative products and made hard decisions to solve ambiguous technical problems. You are now scaling your impact by enabling the team to achieve the same level of technical excellence you’re known for. You'll report directly to our VP of Engineering and work closely with existing engineering leads to create that future.

This is a 4 day, in-office position based in Austin, TX. We are located near Mopac and W. Anderson Lane.

Our engineering team leans senior, with most members having over 10 years of experience at high-growth companies in Austin. As a Senior Engineering Manager, you could:

-

Partner with product to design self-serve customer experiences, defining the technical direction and leading your team to deliver measurable outcomes.

-

Evaluate cutting-edge vendors for detailed property analytics, collaborating with data science to identify early indicators of property conditions and risks.

-

Guide and coach experienced engineers, helping them identify their strengths and charting paths for continued growth and impact.

What You'll Bring

-

Experienced: This isn't your first rodeo leading high-performing engineering teams. While there's no specific minimum number of years, we expect you to confidently navigate complex technical landscapes, mentor senior engineers, and scale teams.

-

Builder: You're passionate about shaping the product through engineering leadership. You'll drive architectural vision, empower your team to build innovative solutions, and foster an environment where engineers contribute thoughtfully to the user experience, rather than just executing pre-defined specs.

-

Pragmatic: You prioritize impact and swift delivery. You'll balance team velocity with technical excellence, making thoughtful trade-offs to solve problems effectively. You know when to leverage off-the-shelf solutions and when a custom approach is essential, and you're ready to guide your team in iteratively building and deploying solutions that move the needle.

-

Specific Languages: We don't really care if you've worked in our stack before as long as you're happy to learn it. If you're sharp enough to be on this team, you're sharp enough to learn any language or framework quickly.

How You'll Contribute

People Management & Team Leadership

-

Build and Grow Teams: Actively participate in the hiring, onboarding, and retention of exceptional engineering talent.

-

Mentorship & Development: Coach, mentor, and foster the career growth of individual engineers through regular one-on-one meetings, constructive feedback, and performance development plans.

-

Team Health & Culture: Cultivate a collaborative team environment where engineers feel empowered to take ownership and contribute their best work.

-

Feedback Culture: Champion a culture of open and direct feedback, both positive and constructive, to drive continuous improvement and trust within the team.

Technical Leadership & Excellence

-

Architectural Guidance: Guide architectural decisions and drive system-level thinking to ensure the scalability, resilience, and maintainability of our software systems.

-

Technical Vision: Define and champion the technical vision and strategy for your domain, ensuring alignment with overall company goals.

-

Code Quality & Standards: Instill a spirit of continuous improvement in code quality, engineering best practices, and operational excellence.

-

Technical Debt Management: Manage technical debt, balancing long-term technical vision with short-term deliverables.

Project & Delivery Oversight

-

Roadmap & Strategy: Partner with product, engineering, and cross-functional teams to define roadmaps, set the direction, and drive customer and business impact for your team's products and features.

-

Execution & Delivery: Oversee the prioritization, planning, execution, and delivery of engineering projects and features with an emphasis on small iterations.

-

Operational Excellence: Ensure operational excellence, including support, on-call rotations, deployments, and incident management, embracing a "you build it, you run it" philosophy.

-

Data analysis: Use data to drive decision making for evaluating features and success, prioritization, and identifying future opportunities.

Cross-functional Collaboration

-

Stakeholder Partnership: Collaborate extensively with Product Managers, Insurance Product, Sales, Marketing, Data Science, and other engineering teams to align priorities, ensure visibility of product and engineering initiatives, and incorporate the company’s priorities.

-

Strategic Alignment: Work with senior leadership to understand the overall business direction, company metrics, provide technical insights, and contribute to strategic decision-making.

Our Technical Stack and Tools:

-

Python 3 / Kotlin

-

Typescript

-

React (Next.js)

-

Django / FastAPI

-

Postgres

-

Kafka (we build on an event driven architecture)

-

AWS (EKS)

-

Github Actions with a full CI/CD Pipeline

Compensation and Benefits:

-

Compensation: Top of market salary + equity

-

Time Off: 3 weeks PTO + 6 federal holidays

-

Insurance: Medical, dental, vision, life, disability, HSA, FSA

-

Retirement: 401(k)

-

Perks: Free snacks, team lunches, collaborative office culture

Location:

-

Candidates are required to be located in or willing to relocate to Austin, TX.

-

We are full time in-office.

Steadily is building a workplace environment of team members who are passionate and excited to be together in person. Our office is in central Austin, and is key to our fast-paced growth trajectory.

Why Join Steadily

-

Good company. Our founders have three successful startups under their belt and have recruited a stellar team to match.

-

Top compensation. We pay at the top of the Austin, TX market (see comp).

-

Growth opportunity: We’re an early-stage, fast-growing company where you’ll wear a lot of hats and shape product decisions.

-

Strong backing. We’re growing fast, we manage over $20 billion in risk, and we’re exceptionally well-funded.

-

Culture: Steadily boasts a very unique culture that our teammates love. We call it like we see it and we’re nothing if not candid. Plus, we love to have a good time. Check out our culture deck to learn what we’re all about.

-

Awards: We've been recognized both locally and nationally as a top place to work. Recently we were ranked 16th on Forbes' 2026 Best Startup Employers list, and 63rd on the prestigious Inc 5000 Fastest Growing Companies list. We've also been recognized as one of the Best Landlord Insurance Companies in 2026 by CNBC, a Top 2025 Startup in Newsweek, in Investopedia's Best Landlord Insurance Companies, and we won Austin Business Journal's Best Places to Work in 2025.

We’re excited to meet you!

More jobs at Steadily Insurance Agency

Similar roles in Austin