AI Jobs Map

Spiko · 75008 Paris

AI & data lead

RemotedirectorPosted 6 days ago
Apply on IndeedIndeedOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

agentic-aibigquerytypescriptreacttailwindllmterraformawsgcpkubernetesdockerpostgresqldatadogragfunctional-programmingblockchainsystem-design

Our Mission

Money sitting idle is money lost. We're fixing that.

Founded in 2023 by Antoine and Paul-Adrien, Spiko gives businesses, non-profits, financial advisers, and fintechs access to institutional-grade cash management, via app or API. We are building the full infrastructure: issuing, operating, and distributing the products ourselves.

Two years after launch, we serve thousands of organizations across Europe and process hundreds of millions of euros in flows every month.

Our ambition: become the world's leading treasury management infrastructure in a market worth trillions.

We are backed by Index Ventures, the CEO of Revolut, the founder of Kyriba, and the CTO of Wise.

Spiko runs on excellence, transparency, and straight talk.

The role: AI & data lead

Your mission is simple: supercharge Spiko with AI.

We are looking for a senior engineer to join Spiko's tech team and take ownership of our AI and data initiatives. The role sits within the tech team and works with the whole company; the ambition is that you build the AI and data team around you as Spiko scales.

Key Responsibilities

-

Embed AI into Spiko's product, to give the CFOs who use Spiko the smoothest cash management experience there is. For example: letting users automate their deposits and withdrawals, run operations in Spiko straight from a prompt, or point their own AI agents at a Spiko MCP server to query positions and perform deposits and withdrawals programmatically.

-

Empower every team to use AI in their day-to-day work, including legal, sales, marketing and ops. For instance, give our customer support AI-assisted drafting and answering.

-

Keep us at the state of the art in AI-assisted software engineering, owning the tooling, practices and infrastructure that make AI a force multiplier for the whole tech team.

-

Own our data platform, evolving and maintaining the analytics infrastructure (BigQuery, Datastream, Metabase, etc.) that makes production data accessible to non-technical teams, and supporting the data initiatives built on top of it.

Our stack

-

Languages and frameworks: Typescript, NX, Effect, React, Tailwind

-

Data & AI: BigQuery, Datastream, Metabase, LLM APIs and agent frameworks

-

Infrastructure: Terraform, AWS, GCP, Kubernetes, Docker, PostgreSQL

-

External services: Ory, Datadog

What's already in place?

Claude is deployed company-wide and all teams use it daily. A handful already run automated recurring workflows in production. Our product data has been queryable in plain language with Claude for almost a year, which means non-technical teams answer their own questions. You'll find a working base that needs an owner to take it to the next level.

Who we’re looking for

Requirements (must-haves):

-

You're a software or AI engineer with 5+ years of experience

-

You're comfortable as an individual contributor as well as managing stakeholders both inside and outside the tech team

-

You are very comfortable with cloud data infrastructure

-

You have hands-on experience building with LLMs (agents, RAG, tool use, evaluation) and shipping AI features to production, not just prototypes

-

You can operate autonomously with non-technical stakeholders: understanding a business team's workflow, scoping the right automation, and delivering it

-

You are comfortable working in an English-speaking environment

-

You are curious and eager to learn, with a problem-solving mindset

Nice to have:

-

You have experience taking ownership of a technical domain across a company (platform, data, or AI enablement roles)

-

You have worked with functional programming patterns (we use Effect heavily)

-

You have built and shipped an MCP server, or agent-facing APIs

-

You have experience in capital markets, fintech or Web3

-

You have worked on tech projects in highly regulated environments (e.g. fintech, regtech, healthtech, edtech, etc.)

What we offer

-

Compensation: Competitive package depending on experience + Stock Options

-

Offices: in central Paris & London

-

Remote work: up to 2 days per week and one full remote week per month

-

The best tech for your job: latest-generation laptops and industry-leading software

-

Health insurance: 100% covered by Spiko

-

Monthly Budget to cover different perks of choice

-

Transport: 50% of public transport pass covered or the Forfait Mobilités Durables (FMD)

-

Referral Bonus

-

Social life: regular afterworks and biannual offsites

Our hiring process

-

Hiring Manager Interview - 30 min with Nicolas, Tech Lead

-

Product interview - 1h with a senior member of our product team (remote)

-

Coding & System design interview - 2h with two engineers from the team (in person, Paris)

-

AI enablement case - 1h with Victor, Chief of Staff (in person, Paris)

-

Final Interviews with the Founders (in person, Paris or London)

-

Reference Check - we'll reach out to your references to gather further insights

-

Offer

If something here doesn't match your résumé perfectly but you believe you'd thrive in this role, apply anyway. Tell us why.

More jobs at Spiko