AI Jobs Map

Albertsons Companies India · Bengaluru, Karnataka, India

Staff Engineer Architect [T500-29319]

seniorfull timePosted 3 days ago
Apply on LinkedInLinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

javajavascripttypescriptspringmicroservicesreactangularcsssassapache-kafkasqlmysqlpostgresqlazurenosqlmongodbcassandraredisgcpdevops

About Albertsons Companies Inc. (ACI):

As a leading food and drug retailer in the United States, Albertsons Companies, Inc. operates over 2,200 stores across 35 states and the District of Columbia. Our well-known banners across the United States, including Albertsons, Safeway, Vons, Jewel-Osco and others, serve more than 36 million U.S customers each week.

We build and shape technology solutions that solve customers’ problems every day, making things easier for them when they shop with us online or in a store. We have made bold, strategic moves to migrate and modernize our core foundational capabilities, positioning ourselves as the first fully cloud-based grocery tech company in the industry.

Our success is built on a one-team approach, driven by the desire to understand and enhance the customer experience. By constantly pushing the boundaries of retail, we are transforming shopping into an experience that is easy, efficient, fun and engaging.

About Albertsons India Capability Center:

At Albertsons India Capability Center, we're not just pushing the boundaries of technology and retail innovation, we're cultivating a space where ideas flourish and careers thrive. Our workplace in India is a vital extension of the Albertsons Companies Inc. workforce and important to the next phase in the company’s technology journey to support millions of customers’ lives every day.

At the Albertsons India Capability Center, we are raising the bar to grow across Technology & Engineering, AI, Digital and other company functions, and transform a 165-year-old American retailer. At Albertsons India Capability Center, associates collaborate directly with international teams, enhancing decision-making processes and organizational agility through exciting and pivotal projects. Your work will make history and help millions of lives each day come together around the joys of food and inspire their well-being.

We are excited to announce an opening for Staff Engineer Software at ACI. Please find below the details of the role and its responsibilities.

Experience Range:

- 9 - 12 years

Position Title: Staff Software Engineer

Mandatory Skills Required:

- Programming Languages: Java (11 / 17+), JavaScript / TypeScript

- Backend & Frameworks: Spring Boot, REST APIs, Microservices, OOAD

- Frontend: ReactJS (or AngularJS), HTML5, CSS / SCSS, JavaScript, responsive design

- Integration & Messaging: Apache Kafka, JMS / ActiveMQ, event-driven design

- SQL Databases: MySQL, PostgreSQL, Oracle, Azure SQL Server

- NoSQL Databases: MongoDB, Cassandra

- Caching: Redis o— cache-aside, TTL and eviction policy, CDN / edge caching

- Cloud: Azure or GCP — hands-on application development

- Containers & DevOps: Docker, Kubernetes, CI/CD with Jenkins / GitHub Actions / Azure DevOps, Git

- Automation Testing: JUnit / TestNG, Jest, Selenium / Playwright / Cucumber, Rest-Assured / Karate

- Application Servers: Tomcat, Apache Jetty, Reactor Netty

- Performance: JVM tuning, query optimization, capacity planning

- Domain: Retail (3+2)

Roles & responsibilities:

- Writes production code daily, conducts code reviews, and works continuously on code quality, testability, and maintainability improvements across the team

- Performs advanced development, support, and implementation of complex systems using specialized domain knowledge and highly developed business expertise

- Partners with Architects on low-level design — translating target-state architecture and reference patterns into detailed component designs, interface contracts, and implementation plans

- Leads large projects and programs with limited or no oversight, from design through production deployment and stabilization

- Evaluates business and software industry trends and suggests improvements to processes, products, and services

- Proposes and champions new ideas, technologies, and process improvements that enhance the development process and product quality; runs POCs to substantiate the case

- Sets standards to deliver high-quality products and services, and sets high standards for self and others

- Backend: builds Java microservices and REST APIs with Spring Boot — service decomposition, API design and versioning, resilience patterns (timeouts, retries, circuit breakers), and secure-by-default implementation

- Frontend: builds and owns ReactJS / AngularJS applications — component architecture, state management, SPA and SSR rendering strategy, accessibility, and Core Web Vitals performance; owns the API-to-UI contract

- Integration: designs and implements event-driven flows with Kafka and JMS / ActiveMQ — partitioning and consumer design, idempotency, retry and dead-letter strategy, replay, and reconciliation

- Data: models and tunes relational and NoSQL stores for access patterns — indexing, query profiling, sharding and partition keys, caching strategy, and schema migration without downtime

- Cloud & Delivery builds and operates cloud-native services on Azure or GCP within the established landing zone — containerized with Docker and Kubernetes, delivered through CI/CD with automated test, quality, and security gates

- Quality: owns the automated testing strategy for their areas across the pyramid — JUnit / TestNG and Mockito, Rest-Assured or Karate for APIs, Jest for components, and Selenium / Playwright / Cucumber for end-to-end

- Performance: analyses and tunes application performance under high-volume, high-availability conditions — JVM and GC tuning, profiling, query optimization, and capacity planning ahead of peak trading

- Production: runs what they build with an SRE mindset — SLIs and SLOs, structured logging, metrics and distributed tracing, graceful degradation, incident response, and on-call participation

- Mentors' senior and mid-level engineers through pairing, design coaching, and review feedback, and raises the engineering bar through reference implementations rather than mandate

- Escalates architecturally significant decisions and cross-cutting risks to the Senior Staff Software Engineer or the architecture team with a recommendation and the trade-offs already worked through

Experience Required:

- 9 – 12 years as a full-stack developer across Java, web, and mobile development technologies

- 7+ years programming in Java with a strong focus on building microservices and REST APIs with Spring Boot / Spring Cloud

- 5+ years developing web applications with ReactJS and/or AngularJS, including component architecture, state management, and testing

- In-depth knowledge of UI / Web 2.0 development — JavaScript, TypeScript, CSS, SCSS, HTML5, AJAX, jQuery, NodeJS — including responsive and mobile-first design and front-end performance

- Advanced knowledge of application servers — Tomcat, Apache Jetty, Reactor Netty — including tuning, thread and connection pool configuration, and failure characteristics

- Strong expertise in relational databases (Oracle, Azure SQL Server, PostgreSQL, MySQL) and NoSQL (MongoDB, Cassandra) — modeling for access patterns, indexing, query optimization, and mobile data handling and synchronization

- Working expertise in caching — Redis or Varnish, cache-aside patterns, TTL and eviction policy, invalidation strategy, and CDN / edge caching

- 4+ years with event streaming and messaging — Kafka (topics, partitioning, consumer groups, schema registry) and JMS / ActiveMQ — including idempotency and error handling

- 3+ years with cloud platform services and application development on Microsoft Azure or GCP

- DevOps experience including setup and management of Docker and/or Kubernetes clusters, plus exposure to Terraform or Infrastructure-as-Code

- Specialized knowledge of CI/CD pipelines using Jenkins, GitHub Actions, or Azure DevOps, with automated quality and security gates

- Advanced knowledge of automated unit testing with JUnit / TestNG and Jest, and automation frameworks such as Selenium, Playwright, Cucumber, Rest-Assured, and Karate; plus, mobile testing tools such as Appium or Espresso

- Advanced expertise in capacity planning, systems performance analysis, and optimization in distributed client / server and mobile environments, including JVM and GC tuning and profiling

- Experience with observability practice — structured logging, metrics, and distributed tracing (Open Telemetry, Prometheus / Grafana, App Insights, Cloud Operations) — and debugging production issues from them

- Hands-on exposure to GenAI or AI-enabled product features — integrating LLM or Vision AI services, or building retrieval and prompt-driven functionality into an application

- Working proficiency in Python for scripting, automation, and data work is an advantage

- Strong expertise in design patterns and architectural principles for building scalable, maintainable applications across web and mobile platforms

- Deep understanding of the full software development lifecycle and Agile methodologies, working in a distributed onshore–offshore model

- Familiarity with GitHub Copilot or similar AI-assisted development tools

Competencies:

- Compassionate and kind, showing courtesy, dignity, and respect. They show sincere interest and empathy for all others

- Foster innovation through creativity to get to a workable solution. Use analytical thinking through issues using logic and reason

- Show integrity in what is done and how it is done - without sacrificing personal/business ethics

- Embrace an inclusion-focused mindset, seeking input from others on their work and encouraging the open expression of diverse ideas and opinions

- Team-oriented, positively contributing to team morale and willing to help

- Learning-Focused, finding ways to improvise in their field and use positive constructive feedback to grow personally and professionally

- Think strategically and proactively anticipate future problems, needs or changes in the work

- Retail Domain Experience is required

- Experienced in mentoring development teams

- Hands-on experience in production environments with an SRE (Site Reliability Engineering) mindset

- Proficient in design patterns and architectural skills, with a proven track record of delivering large-scale initiatives while managing multiple parallel projects effectively

More jobs at Albertsons Companies India