AI Jobs Map

HCL Technologies B.V. Netherland · Amsterdam, North Holland, Netherlands

Advanced Java Developer

seniorfull timePosted today
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

javaspringsqlcassandraapache-kafkaunit-testing

Job Role- Advanced Java Developer with Dutch Speaker

Location - Amsterdam, Netheralands

Job Description-

• Required relevant experience – 7-10 years

• Good development experience in Java 17 and above

• Design, develop, and maintain advanced Java-based applications, adhering to coding standards and best practices.

• Developing APIs using Core Java, Spring Boot, SQL, Cassandra, Elastic etc.,

• Should have worked in Kafka & Messaging Queues

• Collaborate with client and understand the business requirements.

• Defect management and fixing bugs that are raised during integration testing or functional testing.

• Fixing performance issues related to API execution.

• Providing support for production issues by analysing the application logs.

• Providing technical support to teammates in case of any challenges.

• Will be part of code review process to maintain good quality code.

• Conducting knowledge transfer sessions on latest Java technologies

• Good to have - understanding of Payments Domain

• Dutch speaking candidates

For more information on how we process your personal data, please refer to HCLTech’s Candidate Data Privacy Notice.

More jobs at HCL Technologies B.V. Netherland

  • HCL Technologies B.V. Netherland · Amsterdam, North Holland, Netherlands

    yesterday

    Senior Java Software Engineer

    seniorjavaspringapache-kafkanosql+2
  • HCL Technologies B.V. Netherland · Amsterdam, North Holland, Netherlands

    yesterday

    DevOps Engineer

    seniordevopsazureci/cdgrafana+4
  • HCL Technologies B.V. Netherland · Amsterdam, North Holland, Netherlands

    yesterday

    Postgres DBA

    seniorpostgresqlobservabilitylinuxbash+4
  • HCL Technologies B.V. Netherland · Amsterdam, North Holland, Netherlands

    yesterday

    AI Engineer

    seniorcopilotgcpgeminigenerative-ai+4
  • HCL Technologies B.V. Netherland · Amsterdam, North Holland, Netherlands

    7 days ago

    Site Reliability Engineer

    seniorsrenetwork-security