AI Jobs Map

JPMorganChase · Glasgow, Scotland, United Kingdom

Software Engineer III - Data Engineering- Corporate Know Your Customer

full timePosted today
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

pythonmicroservicesapache-kafkaredismemcachedobservabilitysplunkgrafanaapache-airflownosqlawsazuregcpdatabrickssnowflakellmopenaidata-engineeringsystem-designapache-spark

Job Description

Join us to shape the future of financial technology and make a meaningful impact on millions of customers worldwide.

As a Software Engineer at JPMorgan Chase in the Corporate Sector's agile data engineering team, you will promote the development of a trusted Global Know Your Customer (KYC) and Risk Assessment Data Platform. You will work across multiple teams, define architecture and engineering standards, and deliver high-impact software that scales. You'll collaborate with colleagues to implement secure, stable, and scalable solutions, and help shape the team's culture and technical direction. Your expertise will support the firm's portfolios and contribute to our ongoing success.

Job Responsibilities

- Develop secure, high-quality production code for data-intensive applications and platforms

- Review code and mentor engineers to foster growth and excellence

- Create durable, reusable software frameworks and patterns for use across teams

- Drive adoption of advanced technical methods and industry-standard practices

- Advise cross-functional teams on technological matters within your domain

- Apply knowledge of tools within the Software Development Life Cycle, including AI-assisted development and automation

- Enhance automation at scale to improve value and efficiency

- Lead architectural decisions and engineering practices across multiple teams

- Collaborate with stakeholders to deliver impactful solutions

- Champion best practices in software development and data engineering

- Support a culture of innovation, inclusion, and continuous improvement

Required Qualifications, Capabilities, And Skills

- Hands-on experience delivering system design, application development, testing, and operational stability at enterprise scale

- Expertise in Python and/or PySpark

- Knowledge of software application development and technical processes, with depth in disciplines such as cloud, AI/ML, or data engineering

- Experience in large-scale data processing, microservices, API design, Kafka, Redis, MemCached, observability tools (Dynatrace, Splunk, Grafana), and orchestration frameworks (Airflow, Temporal)

- Advanced working knowledge of relational and NoSQL databases, vector stores, data lake architectures, and data governance

- Practical cloud-native experience (AWS, Azure, or GCP)

- Ability to present and communicate effectively with senior leaders and executives

- Commitment to inclusive, collaborative teamwork

- Good problem-solving and analytical skills

- Adaptability in a fast-paced environment

- Focus on delivering secure and scalable solutions

Preferred Qualifications, Capabilities, And Skills

- Experience with modern data platforms such as Databricks or Snowflake

- Deep hands-on experience with Spark/PySpark and other big data processing technologies

- Expertise in open-source table formats and catalog services such as Apache Iceberg

- Experience with LLM orchestration frameworks and model serving infrastructure or managed endpoints (AWS Bedrock, Azure OpenAI)

- Familiarity with emerging technologies in data engineering

- Ability to drive innovation and continuous improvement

- Passion for mentoring and developing others

About Us

J.P. Morgan is a global leader in financial services, providing strategic advice and products to the world's most prominent corporations, governments, wealthy individuals and institutional investors. Our first-class business in a first-class way approach to serving clients drives everything we do. We strive to build trusted, long-term partnerships to help our clients achieve their business objectives.

We recognize that our people are our strength and the diverse talents they bring to our global workforce are directly linked to our success. We are an equal opportunity employer and place a high value on diversity and inclusion at our company. We do not discriminate on the basis of any protected attribute, including race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, marital or veteran status, pregnancy or disability, or any other basis protected under applicable law. We also make reasonable accommodations for applicants' and employees' religious practices and beliefs, as well as mental health or physical disability needs. Visit our FAQs for more information about requesting an accommodation.

About The Team

Our professionals in our Corporate Functions cover a diverse range of areas from finance and risk to human resources and marketing. Our corporate teams are an essential part of our company, ensuring that we're setting our businesses, clients, customers and employees up for success.

More jobs at JPMorganChase

Software Engineer III - Data Engineering- Corporate Know Your Customer at JPMorganChase (Glasgow, Scotland, United Kingdom) | AI Jobs Map