AI Jobs Map

Cimpress India · Bengaluru, Karnataka, India

Senior Software Engineer (MLOps)

Remoteseniorfull timePosted 7 days ago
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

mlopsmicroservices.netawsreacttypescriptterraformmachine-learningpythontest-automationc#data-structuresjavascriptapache-sparkdata-engineering

Who We Are

Cimpress Technology develops cutting-edge, best-in-world software that powers our mass customization businesses and helps create personalized products for more than 17 million customers globally.

Our Mass Customization Platform is built on modular, multi-tenant services that allow our businesses to choose the solutions they need or combine them to create custom experiences. This helps them move faster — whether it’s launching new products, reaching customers, or managing and tracking orders.

We believe in giving our engineers the ownership and autonomy to make a real impact. Teams define their own roadmaps and choose the technologies and programming languages that best fit their needs. This allows us to operate at enterprise scale while retaining the agility, ownership, and entrepreneurial spirit of a smaller organization.

About the Team

The Data Domain is focused on transforming Cimpress businesses into data-driven organizations.

We build platform products that enable businesses to ingest, store, transform, and use data to generate meaningful insights. Following a data mesh approach, we promote decentralized, domain-driven ownership of data, treat data as a product, and provide teams with a self-service data platform.

What You’ll Do

As a Senior Software Engineer – MLOps, you’ll be part of a cross-functional, T-shaped team working with colleagues and teams across the globe.

You’ll have the opportunity to understand business problems, design scalable solutions, contribute to technical direction, and make meaningful engineering decisions with a high degree of autonomy.

Your responsibilities will include:

- Design, develop, and maintain cloud-native applications and microservices using .NET and AWS.

- Contribute to front-end development using React and TypeScript where required.

- Design and manage cloud infrastructure and provision infrastructure dynamically using Terraform.

- Drive the evolution of MLOps capabilities across the platform, including identifying gaps, evaluating capabilities, and driving improvements.

- Enable reliable machine learning workflows, including model development, orchestration, deployment, and production use.

- Develop and maintain Python libraries and APIs used by Data Engineers and Data Scientists.

- Collaborate with cross-functional teams to understand business and technical requirements and translate them into scalable solutions.

- Design and implement secure, reliable, and efficient APIs and microservices.

- Contribute to code reviews, automated testing, and engineering best practices.

- Create technical documentation and guides that help teams adopt and use platform capabilities effectively.

- Participate in Agile practices such as planning, refinement, and team discussions.

What You’ll Bring

At Cimpress, we value the experience and perspective each person brings. If you don’t meet every qualification listed below, we still encourage you to apply — we’d love to hear your story.

- 5+ years of experience in software engineering, with strong experience building microservices, cloud-native, and data-intensive applications.

- Strong understanding of the MLOps ecosystem, including feature engineering, model training, model deployment, and batch and real-time inference.

- Experience with machine learning platform concepts such as feature stores, model registries, and model serving.

- Strong programming and object-oriented design skills, preferably with .NET/C#.

- Good understanding of software design principles, data structures, and algorithms.

- Experience with modern web development and at least one JavaScript framework.

- Experience working with cloud platforms, preferably AWS.

- Ability to work independently, solve problems creatively, and learn new technologies in a cross-functional environment.

- Strong communication and collaboration skills, with good fluency in English.

- Experience working effectively in an Agile environment.

Nice to Have

- Experience working in remote-first and asynchronous teams.

- Experience with Terraform or Infrastructure as Code.

- Experience with React and TypeScript.

- Hands-on experience with Python and PySpark.

- Experience designing and implementing scalable data engineering or ML orchestration pipelines.

- Experience deploying machine learning solutions in e-commerce or similar domains.

- Experience building production-grade machine learning platforms or solutions.

Why You’ll Love Working Here

At Cimpress, work is more than just a job. It’s an opportunity to learn, grow, experiment, and make an impact.

We encourage people to step outside their comfort zones, explore new ideas, and take ownership of meaningful problems. Through collaboration, innovation, and exposure to different perspectives and technologies, you’ll have plenty of opportunities to grow — both in your career and as an individual.

We’re Remote-First

Cimpress has been Remote-First since 2020.

Our teams have the flexibility and autonomy to work from wherever they are most productive, while still having access to collaboration spaces when meeting in person adds value.

Remote-first for us is built on trust, ownership, and flexibility, enabling our teams to do their best work while collaborating effectively across locations and time zones.

Commitment to Diversity, Equity & Inclusion

We believe that diverse perspectives make us stronger.

We’re committed to building an inclusive environment where everyone feels respected, valued, and empowered to contribute. We strive to create a culture where people can bring their authentic selves to work, collaborate openly, and have the opportunity to make an impact.

Equal Opportunity Employer

Cimpress Technology is an Equal Opportunity Employer. All qualified candidates will receive consideration for employment without regard to race, color, sex, national or ethnic origin, nationality, age, religion, citizenship, disability, medical condition, sexual orientation, gender identity or presentation, legal or preferred name, marital status, pregnancy, family structure, veteran status, or any other basis protected by applicable human rights laws or regulations.

We are committed to creating a workplace where everyone has an equal opportunity to succeed.

More jobs at Cimpress India