AI Jobs Map

Qfyre TechLabs · Greater Chennai Area

AI-Assisted Quality Engineer

Hybridfull timePosted Aug 11
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

devopsci/cddevsecopsseleniumplaywrightcypressjavapythonjavascripttypescriptgraphqlllmragcopilotgithubtest-automationunit-testingsystem-designapi-testingrest-api

About This Role

Quality Engineering is no longer just about finding defects, it's about preventing them, predicting them, and continuously improving software quality through intelligent automation. You'll design intelligent quality pipelines that leverage AI-assisted test generation, predictive defect analysis, self-healing automation, and continuous quality insights to accelerate software delivery while improving reliability. Working closely with developers, product teams, DevOps engineers, and business stakeholders, you'll ensure quality is built into every stage of the software development lifecycle.

What You Will Do

- Design, develop, and maintain scalable automated testing frameworks for enterprise applications

- Build AI-assisted test automation solutions that improve testing speed, coverage, and accuracy

- Leverage AI to generate, optimise, and maintain functional, regression, API, and integration test cases

- Implement predictive defect analysis to identify quality risks early in the development lifecycle

- Integrate automated testing into CI/CD pipelines to enable continuous quality engineering

- Collaborate with Developers, Product Managers, DevOps Engineers, and Business Analysts to define quality strategies

- Validate AI-powered applications, conversational interfaces, and intelligent business workflows

- Perform functional, API, database, performance, and end-to-end testing across distributed systems

- Analyse quality metrics and recommend improvements to engineering teams

- Champion Quality Engineering best practices across Agile and DevSecOps environments

What You Need to Succeed

- 3-8 years of experience combining automation expertise with AI-driven testing practices

- Test automation proficiency across Selenium, Playwright, Cypress, or Appium, with strong programming skills in Java, Python, or JavaScript/TypeScript

- API testing experience with Postman, REST APIs, GraphQL, or SOAP

- AI-assisted test case generation and self-healing automation framework experience

- Experience testing AI-powered applications, LLMs, and conversational interfaces, or validating Retrieval-Augmented Generation (RAG) applications

- Comfort with GitHub Copilot, Cursor, or similar AI engineering assistants

What Will Give You an Edge

- AI-generated synthetic test data creation experience

- AI-powered defect prediction and risk analysis exposure

- Performance testing experience with JMeter, LoadRunner, or Gatling

- Domain depth in Banking and Financial Services, Healthcare, Retail and eCommerce, Manufacturing, Telecom, or Technology and SaaS

What Qfyre Offers

- Genuine ownership of quality strategy for AI-enabled applications, not just test execution

- Exposure to cutting-edge AI-assisted testing tools and frameworks

- Competitive compensation reflecting current market demand for this profile

- Flexible work arrangement, Onsite, Hybrid or Remote depending on the engagement

Skills and Technologies

Test AutomationSeleniumPlaywrightAI Test GenerationCI/CDAPI Testing

Apply

Apply for AI-Assisted Quality Engineer

Complete the form below. Our team reviews every application personally, no automated filtering, no keyword matching. We will be in touch within two business days.

Full Name

Email

Phone

+91 +1 +44 +971 +65 +61 +49 +353

LinkedIn Profile URL

GitHub Profile URL

Portfolio / Website URL

Optional, but sharing any of these helps us get to know your work faster.

Current Location

Open to Relocation?

Current CTC

Expected CTC

Years of Relevant Experience

Cover Note / Why This Role

Upload Resume

Drag and drop or browse to upload

PDF, DOC, or DOCX, max 5MB

Your application is reviewed by a domain expert, not an ATS. We do not share your details without your consent. See our Privacy Policy.

More jobs at Qfyre TechLabs