AI Jobs Map

Nscale · Singapore, Singapore

AI Product Engineer

full timePosted 14 days ago
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

generative-aiobservabilitypythontypescriptgraphqlsystem-designllmagentic-aikubernetesreact

About Nscale

Nscale is taking on the hyperscalers by building a vertically integrated GenAI cloud platform. We own the data centres, software, and applications that power today's AI stack using sustainable technology solutions. We thrive on a culture of relentless innovation, ownership, and accountability, where every team member takes pride in their work and drives it with excellence and urgency. As a Nscaler, you'll build trust through openness and transparency, where everyone is inspired to do their best work. Collaboration is key, and we work together swiftly and respectfully, embracing adaptability and resilience in all we do.

About The Role

Nscale is looking for an AI Product Engineer II to join our product engineering team. You'll own features end-to-end — from design through to production — across the AI services platform, APIs, and developer tooling that AI teams depend on every day.

This is a role where your work has a direct line to customers. You'll collaborate closely with product, design, and AI infrastructure teams, and grow your engineering depth in a fast-moving environment building some of the most critical infrastructure in AI.

Responsibilities

- Design and deliver product features end-to-end within the team's domain

- Own the quality, reliability, and observability of your delivered components

- Identify edge cases, technical debt, and opportunities for improvement proactively

- Contribute to design documents and participate in technical decision-making discussions

- Support newer team members through code reviews and pairing sessions

- Collaborate across product, design, and AI infrastructure teams to deliver cohesive experiences

- Maintain a clear and shared understanding of the codebase within your squad

Requirements

- 2–5 years of software engineering experience

- Strong proficiency in backend or full-stack development (Python, TypeScript, Go, or similar)

- Experience building and maintaining REST or GraphQL APIs in production

- Solid understanding of cloud platform design patterns and distributed systems fundamentals

- Demonstrated ability to take ownership of features and drive them to completion independently

- Attention to detail: edge cases, error handling, and test coverage are first-class concerns

Preferred

- Experience building AI-integrated product features (LLM APIs, model management, agentic UX)

- Familiarity with Kubernetes and cloud-native deployment patterns

- Experience with developer-facing products, CLIs, or SDKs

- Exposure to TypeScript/React for building developer-facing tooling or lightweight web surfaces

About Nscale

Nscale is taking on the hyperscalers by building a vertically integrated GenAI cloud platform. We own the data centres, software, and applications that power today's AI stack using sustainable technology solutions.

We operate with a culture of relentless innovation, ownership, and accountability. As a Nscaler, you'll build trust through openness and transparency, and work alongside a team that values speed, collaboration, and excellence. We move quickly, think boldly, and take pride in delivering systems that matter.

For information on how Nscale handles candidate personal data, please see our Employee & Candidate Privacy Notice: Here.

More jobs at Nscale