AI Jobs Map

Walmart Global Tech India · Bengaluru, Karnataka, India

(IND) SENIOR, SOFTWARE ENGINEER

seniorfull timePosted today
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

javaspringmicroservicesllmragagentic-aisqlmysqlpostgresqlnosqlcassandradynamodbredismemcachedapache-kafkaistiokubernetesazuregcpci/cd

Job Description Summary:

Responsible for coding, unit testing, building high performance and scalable applications that meet the needs of millions of Walmart-International customers, in the areas of supply chain management & Customer experience.

About Team:

Our team collaborates with Walmart International, which has over 5,900 retail units operating outside of the United States under 55 banners in 26 countries including Africa, Argentina, Canada, Central America, Chile, China, India, Japan, and Mexico, to name a few.

What you'll do:

You are responsible for coding, unit testing, building high performance and scalable applications that meet the needs of millions of Walmart-International customers, in the areas of supply chain management & Customer experience.

You are expected to be more intellectually curious engineer who is passionate about domain/technology in general.

What you'll bring:

Java (11/17/21+) — Proficiency in modern Java features including records, sealed classes, virtual threads, and pattern matching

JVM Internals — GC tuning, memory model, class loading, and performance profiling

Spring Boot / Spring Framework — Building production-grade microservices with Spring MVC, Spring Security, and Spring Data

RESTful + GQL API Design — API versioning, pagination, error handling, and Swagger documentation

Concurrency & Multithreading — Executors, Completable Future, reactive streams, and thread-safe design patterns

AI Understanding — LLMs, GenAI Integration, RAG, Vector DBs, Agentic AI

SQL & Relational Databases — Advanced SQL, query optimization, indexing strategies (MySQL, PostgreSQL, AzureSQL)

NoSQL Databases — Experience with Cassandra, Cosmos DB, or DynamoDB for high-throughput workloads

Caching — Redis or Memcached for distributed caching strategies

Kafka / Event Streaming — Event-driven architecture, producers/consumers, and exactly-once semantics

Microservices Architecture — Service decomposition, inter-service communication (sync/async), and domain-driven design

Design Patterns — GoF patterns, SOLID principles, and distributed system patterns (Circuit Breaker, Saga, CQRS)

System Design — Ability to design scalable, fault-tolerant systems handling high throughput (Walmart-scale traffic)

API Gateway & Service Mesh — Experience with Istio, Envoy, or similar service mesh technologies

Kubernetes / WCNP — Container orchestration, pod lifecycle, deployments, and scaling strategies

Cloud Platforms — Azure or GCP experience for cloud-native application deployment

CI/CD Pipelines — Concord, Looper, Jenkins, or similar tools for build and deployment automation

Infrastructure as Code — Terraform or equivalent for managing cloud resources

Testing — Unit (JUnit 5, Mockito), integration, contract testing, and TDD/BDD practices

Observability — Distributed tracing, logging (SLF4J/Logback), and metrics (Grafana, Prometheus, Splunk)

Code Quality — SonarQube, static analysis, code coverage (>85%), and secure coding practices

Git & GitHub — Branching strategies, code reviews, and pull request workflows

Build Tools — Maven or Gradle for dependency management and build automation

Containerization — Docker for building and managing container images

Technical Mentorship — Ability to mentor IN2/IN3 engineers and lead technical discussions

Cross-team Collaboration — Experience working with distributed teams across time zones

Technical Documentation — Writing clear design docs, ADRs, and runbooks

Problem Solving — Strong debugging skills and root cause analysis in production environments

Ownership & Accountability — End-to-end ownership from design through production support

About Walmart Global Tech

Imagine working in an environment where one line of code can make life easier for hundreds of millions of people. That’s what we do at Walmart Global Tech. We’re a team of software engineers, data scientists, cybersecurity expert's and service professionals within the world’s leading retailer who make an epic impact and are at the forefront of the next retail disruption. People are why we innovate, and people power our innovations. We are people-led and tech-empowered.

We train our team in the skillsets of the future and bring in experts like you to help us grow. We have roles for those chasing their first opportunity as well as those looking for the opportunity that will define their career. Here, you can kickstart a great career in tech, gain new skills and experience for virtually every industry, or leverage your expertise to innovate at scale, impact millions and reimagine the future of retail.

Work

Walmart’s culture sets us apart, and we know being together helps us innovate, learn and grow great careers. This role is based in our Bangalore office for daily work, with the flexibility for associates to manage their personal lives

Benefits

Beyond our great compensation package, you can receive incentive awards for your performance. Other great perks include a host of best-in-class benefits maternity and parental leave, PTO, health benefits, and much more.

Belonging

We aim to create a culture where every associate feels valued for who they are, rooted in respect for the individual. Our goal is to foster a sense of belonging, to create opportunities for all our associates, customers and suppliers, and to be a Walmart for everyone.

At Walmart, our vision is "everyone included." By fostering a workplace culture where everyone is—and feels—included, everyone wins. Our associates and customers reflect the makeup of all 19 countries where we operate. By making Walmart a welcoming place where all people feel like they belong, we’re able to engage associates, strengthen our business, improve our ability to serve customers, and support the communities where we operate.

Equal Opportunity Employer

Walmart, Inc., is an Equal Opportunities Employer – By Choice. We believe we are best equipped to help our associates, customers and the communities we serve live better when we really know them. That means understanding, respecting and valuing unique styles, experiences, identities, ideas and opinions – while being inclusive of all people.

Minimum Qualifications...Outlined below are the required minimum qualifications for this position. If none are listed, there are no minimum qualifications.

Option 1: Bachelor's degree in computer science, computer engineering, computer information systems, software engineering, or related area and 3 years’ experience in software engineering or related area.

Option 2: 5 years’ experience in software engineering or related area.

Preferred Qualifications...Outlined below are the optional preferred qualifications for this position. If none are listed, there are no preferred qualifications.

Master’s degree in computer science, information technology, engineering, information systems, cybersecurity, or related area and 1 year’s experience leading information security or cybersecurity projects, We value candidates with a background in creating inclusive digital experiences, demonstrating knowledge in implementing Web Content Accessibility Guidelines (WCAG) 2.2 AA standards, assistive technologies, and integrating digital accessibility seamlessly. The ideal candidate would have knowledge of accessibility best practices and join us as we continue to create accessible products and services following Walmart’s accessibility standards and guidelines for supporting an inclusive culture.

Information Technology - CISCO Certification - CertificationPrimary Location...Block- 1, Prestige Tech Pacific Park, Sy No. 38/1, Outer Ring Rd Kadubeesanahalli , India

More jobs at Walmart Global Tech India