AI Jobs Map

Impact Analytics · Bengaluru, Karnataka, India

Lead Software Engineer (Backend - Python)

seniorfull timePosted 9 days ago
Apply on LinkedInOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

pythonagentic-aillmgenerative-airest-apidjangoflaskfastapisystem-designcryptographymicroservicestime-series

About Impact Analytics

Impact Analytics is an agentic-first AI software company transforming retail merchandising through cutting-edge AI, LLMs, and Generative AI technologies.

As a fast-growing Series D company with deployments across five continents, it is building both industry-leading merchandising solutions and foundational AI agents that are redefining how retail decisions are made. What makes Impact Analytics unique is its combination of deep retail domain expertise, strong innovation culture, and global presence. It is one of the few India-born AI companies recognized globally by organizations like Fortune, Gartner, and the Inc. 5000. For candidates looking to work on next-generation AI products with global scale and real-world impact, Impact Analytics is an exciting place to build your career. Here’s a link to our website: www.impactanalytics.co.

The impact that you will be making

Create an impact with a B2B SaaS product company and change the face of enterprise analytics

What Lands You In This Role

- 5+ years of experience in back-end software development in Python and its web frameworks.

- Good understanding of the Rest API design and development.

- Expertise in at least one of Django, Flask or FastAPI

- Familiarity with Object Relational Mapping libraries and ability to integrate with multiple data sources into one system

- Understanding of limitations of Python and Multi Process Architecture

- Good understanding of the Architecture and Software / System design principles.

- Good understanding of Scalability (Vertical / Horizontal), Distributed systems & High Availability.

- Good understanding of the Cross Cutting concerns (Caching, Queuing, Logging, Security (Authentication / Authorization / Encryption)).

- Good understanding of Microservices design and containerization technologies

- Good team leadership skills.

- Good written and communication skills.

What We Offer

- An opportunity to develop some of the best enterprise SaaS products to be built out of India

- Opportunities to quench your thirst for problem-solving, experimenting, learning, and implementing innovative solutions

- A flat, collegial work environment, with a work hard, play hard attitude

- A platform for rapid growth if you are willing to try new things without fear of failure.

- Remuneration with best in class industry standards with generous health insurance cover.

Some Of Our Accolades Include

- Ranked as one of America's Fastest-Growing Companies by Financial Times for five consecutive years: 2020-2024.

- Ranked as one of America's Fastest-Growing Private Companies by Inc. 5000 for seven consecutive years: 2018-2024.

- Voted #1 by more than 300 retailers worldwide in the RIS Software LeaderBoard 2024 report.

- Ranked #72 in America’s Most Innovative Companies list in 2023—by Fortune—alongside companies like Microsoft, Tesla, Apple, IBM, etc.

- Forged a strategic partnership with Google to equip retailers with cutting-edge generative AI tools.

- Recognized in multiple Gartner reports, including Market Guides and Hype Cycle, spanning assortments, merchandising, forecasting, algorithmic retailing, and Unified Price, Promotion, and Markdown Optimization Applications.

More jobs at Impact Analytics

  • Impact Analytics · Bengaluru, Karnataka, India

    6 days ago

    Lead Software Engineer - Golang

    seniorgolangagentic-aillmetl+4
  • Impact Analytics · Bengaluru, Karnataka, India

    10 days ago

    Project Leader

    senioragentic-aillmgenerative-aidata-science+2
  • Impact Analytics · Bengaluru, Karnataka, India

    10 days ago

    Lead QA Automation Engineer

    senioragentic-aillmgenerative-aici/cd+4
  • Impact Analytics · Bengaluru, Karnataka, India

    10 days ago

    Senior AI Engineer

    senioragentic-aillmgenerative-aimachine-learning+4
  • Impact Analytics · Bellandur, Bengaluru, Karnataka

    11 days ago

    Engineering Manager - Backend

    Hybridagentic-aillmgenerative-aipython+4