AI Jobs Map

Goldman Sachs · Singapore

Foundation Engineering, AI Platform, GenAI Search and Document Management Developer, Associate, Singapore

full timePosted Aug 14
Apply on IndeedIndeedOpens the original posting. AI Jobs Map never asks for your details.

Stack mentioned

agentic-airagjavaapache-kafkaelasticsearchgrpcmongodbmicroservicespythonnlpgenerative-aivector-databases

Goldman Sachs has a unique and differentiated set of data, including proprietary content, analytics, and research; leveraging these unique datasets and content will enable the firm to double down on its existing strengths and harness the power of Generative AI.

We are seeking for highly motivated Engineers to join our Search and DocAI organization.

The platform you will build acts as a central knowledge layer for the firm’s data which serves relevant search results to a diverse set of agentic systems and tools. You will be building a low latency distributed system that powers the Search system along with building capabilities that enhances search efficiency and accuracy of agentic use cases across the firm. You will play a pivotal role in driving the adoption of cutting-edge Generative AI technologies at the firm interacting directly with our business.

In this role, you will have the opportunity to contribute to various Generative AI domains, including boosting developer productivity with Retrieval-Augmented Generation (RAG) pipelines and knowledge graphs for information retrieval.

You will help address the unique challenges that arise in generative AI systems within the financial domain and contribute to the development of Goldman’s AI Assistant to empower our business.

What you will do

- Collaborating effectively with colleagues to build an AI enabled platform for Document Digitization and Search.

- Conceptualizing, experimenting with, and assessing AI-based software systems.

- Developing, testing, and maintaining high-quality, scalable. production-ready code.

- Demonstrating technical leadership by taking charge of cross-team projects.

- Developing and deploying services in cloud native environment.

- Contributing to boost developer productivity with Generative AI.

Required Qualifications

- Backend java developer with experience writing multi-threaded, concurrent, scalable, and distributed applications. Must be update on current and opensource stack - Kafka, ElasticSearch, gRPC, MongoDb etc,

- Experience with writing microservices and distributed applications

- Knowledge of Python especially in the NLP and data manipulation area

- Knowledge of how search engines work and LUCENE

- Knowledge of vector database is a plus

We Offer Best-In-Class Benefits

Healthcare & Medical Insurance

We offer a wide range of health and welfare programs that vary depending on office location. These generally include medical, dental, short-term disability, long-term disability, life, accidental death, labor accident and business travel accident insurance.

Holiday & Vacation Policies

We offer competitive vacation policies based on employee level and office location. We promote time off from work to recharge by providing generous vacation entitlements and a minimum of three weeks expected vacation usage each year.

Financial Wellness & Retirement

We assist employees in saving and planning for retirement, offer financial support for higher education, and provide a number of benefits to help employees prepare for the unexpected. We offer live financial education and content on a variety of topics to address the spectrum of employees’ priorities.

Health Services

We offer a medical advocacy service for employees and family members facing critical health situations, and counseling and referral services through the Employee Assistance Program (EAP). We provide Global Medical, Security and Travel Assistance and a Workplace Ergonomics Program. We also offer state-of-the-art on-site health centers in certain offices.

Fitness

To encourage employees to live a healthy and active lifestyle, some of our offices feature on-site fitness centers. For eligible employees we typically reimburse fees paid for a fitness club membership or activity (up to a pre-approved amount).

Child Care & Family Care

We offer on-site child care centers that provide full-time and emergency back-up care, as well as mother and baby rooms and homework rooms. In every office, we provide advice and counseling services, expectant parent resources and transitional programs for parents returning from parental leave. Adoption, surrogacy, egg donation and egg retrieval stipends are also available.

Benefits at Goldman Sachs

Read more about the full suite of class-leading benefits our firm has to offer.

Opportunity Overview

CORPORATE TITLEAssociate

OFFICE LOCATION(S)Singapore

JOB FUNCTIONSoftware Engineering

DIVISIONEngineering Division

More jobs at Goldman Sachs